(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE611

CP000435.PE611       Location/Qualifiers
FT   CDS             601045..602556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0632"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="identified by similarity to SP:Q59650; match to
FT                   protein family HMM PF01225; match to protein family HMM
FT                   PF02875; match to protein family HMM TIGR01085"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47620"
FT                   /db_xref="GOA:Q0ICH2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICH2"
FT                   /protein_id="ABI47620.1"
FT                   /translation="MTQRLHALLHSVGLPVPQGLSDAVIESITCDSRCVGPGSVFIGLP
FT                   GGRVDGGSFWPKALVDGASAVLIGSAAAATLPPEQSDAVLVVPDPVARWAGELAAAFWN
FT                   HPSERIGLIGVTGTNGKTTTTHLIEHLSSACGRPSALFGTLLNRWPGHSVTATHTTAVA
FT                   DRLQAQLAEAYAAGAQLTAMEVSSHALDQHRVAGCRFSGAVFTNLTQDHLDYHETMASY
FT                   FEAKARLFAPPLVADQGAQFVVNIDDPWGKHLAERLGDRCWRSSLSEGSAHAELTMSDL
FT                   VMGSSGVEGRLLSPLGEGSFQSPLLGRFNVMNLLQAVGVLLQQGLPLEALLEAISTFRG
FT                   VPGRMERVVVDGKGGELPTVLVDYAHTPDGLSSALNACRPFADGKLICVFGCGGDRDRG
FT                   KRSQMAAIAAELADAVVVTSDNPRTEDPQQILNDVVEGIPSGTALTVMLDRAEAIAGAI
FT                   KDAGSHDLVLIAGKGHEDYQILGTQKVHFDDREQALKALQDKLIF"
     MTQRLHALLH SVGLPVPQGL SDAVIESITC DSRCVGPGSV FIGLPGGRVD GGSFWPKALV        60
     DGASAVLIGS AAAATLPPEQ SDAVLVVPDP VARWAGELAA AFWNHPSERI GLIGVTGTNG       120
     KTTTTHLIEH LSSACGRPSA LFGTLLNRWP GHSVTATHTT AVADRLQAQL AEAYAAGAQL       180
     TAMEVSSHAL DQHRVAGCRF SGAVFTNLTQ DHLDYHETMA SYFEAKARLF APPLVADQGA       240
     QFVVNIDDPW GKHLAERLGD RCWRSSLSEG SAHAELTMSD LVMGSSGVEG RLLSPLGEGS       300
     FQSPLLGRFN VMNLLQAVGV LLQQGLPLEA LLEAISTFRG VPGRMERVVV DGKGGELPTV       360
     LVDYAHTPDG LSSALNACRP FADGKLICVF GCGGDRDRGK RSQMAAIAAE LADAVVVTSD       420
     NPRTEDPQQI LNDVVEGIPS GTALTVMLDR AEAIAGAIKD AGSHDLVLIA GKGHEDYQIL       480
     GTQKVHFDDR EQALKALQDK LIF                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page