(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE613

CP000435.PE613       Location/Qualifiers
FT   CDS             complement(603752..605035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0634"
FT                   /product="hydrophobic amino acid ABC transporter (HAAT)
FT                   family, periplasmic amino acid-binding protein"
FT                   /note="identified by match to protein family HMM PF01094"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46361"
FT                   /db_xref="GOA:Q0ICH0"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICH0"
FT                   /protein_id="ABI46361.1"
FT                   /translation="MESKAARTTDAIAKMFHFLRLRTFVMKKRAANHKSVLPVKLIATI
FT                   LRRSTLITFGLSLSIAATSAQQKDTQITSDSKNTILLGQSLPLSGPSAQIGKKYQAGAQ
FT                   AWFNEVNRQGGINGKKIRLISLDDQYEPELTISNTKTLLEKPNLLALFGYVGTPTTKEI
FT                   LPFIEERKVPLIAPLTGASILRDEKLKMVVNLRASYQMEIDKIVDSLVRNARQKIAIIY
FT                   QDDAFGKDGLKSAESALKKHGLKPIATATVQRNSAKIQSALQVLISSQPNAIIIISTYV
FT                   SSAALSRELLKRDVNAQIMNVSFVGTRALEQSLPVGLANGIGVSQVVPFPWDRWIPVVA
FT                   DYQRLMRVNNSSARFGFTSLEGFMAARLITEGIKKVQGPLTKESLIKSLKSIKKVDLGG
FT                   FQLDLSSNNKQASDYVELTFFGAQQWEP"
     MESKAARTTD AIAKMFHFLR LRTFVMKKRA ANHKSVLPVK LIATILRRST LITFGLSLSI        60
     AATSAQQKDT QITSDSKNTI LLGQSLPLSG PSAQIGKKYQ AGAQAWFNEV NRQGGINGKK       120
     IRLISLDDQY EPELTISNTK TLLEKPNLLA LFGYVGTPTT KEILPFIEER KVPLIAPLTG       180
     ASILRDEKLK MVVNLRASYQ MEIDKIVDSL VRNARQKIAI IYQDDAFGKD GLKSAESALK       240
     KHGLKPIATA TVQRNSAKIQ SALQVLISSQ PNAIIIISTY VSSAALSREL LKRDVNAQIM       300
     NVSFVGTRAL EQSLPVGLAN GIGVSQVVPF PWDRWIPVVA DYQRLMRVNN SSARFGFTSL       360
     EGFMAARLIT EGIKKVQGPL TKESLIKSLK SIKKVDLGGF QLDLSSNNKQ ASDYVELTFF       420
     GAQQWEP                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page