(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE614

CP000435.PE614       Location/Qualifiers
FT   CDS             604959..606197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0635"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46675"
FT                   /db_xref="GOA:Q0ICG9"
FT                   /db_xref="InterPro:IPR036719"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICG9"
FT                   /protein_id="ABI46675.1"
FT                   /translation="MTKVRRRRKWNILAIASVVLAALLSIIGVTSLNVDQVPGRDSLRL
FT                   SSASRALTTSADRLPRDGWSSQRGESLSGSEIQADIEALDDAKYHVKIGVYSNSTYDLD
FT                   LSIPSFSSNGYVWMRWKQPLQDYLEANNTDLQEHISLLNALLSDADPVLHPVQDKPAVL
FT                   SDGTYYQLYTYVGRFYIDSATFKRFPFLTISLPIAIEADDVAGGLGYTKLRFEPDIRNS
FT                   GMGLYAGTGIIGWLNRGWSIAEYRHNYATNFGLGGLDRDYSLIVYDITFGTSSWSSFWR
FT                   LMLPLLVVMVMVLLVFKIRPDEQDARAGIPVTVLLTLVFLQQVYRGELPDLPFLTFLDL
FT                   VYVIAYVITLFAFVLLVWIGRRYADMERMPLGEARDNLSKRLELLDEVWPLSMVLFCSV
FT                   AVVTAWVLIPPGS"
     MTKVRRRRKW NILAIASVVL AALLSIIGVT SLNVDQVPGR DSLRLSSASR ALTTSADRLP        60
     RDGWSSQRGE SLSGSEIQAD IEALDDAKYH VKIGVYSNST YDLDLSIPSF SSNGYVWMRW       120
     KQPLQDYLEA NNTDLQEHIS LLNALLSDAD PVLHPVQDKP AVLSDGTYYQ LYTYVGRFYI       180
     DSATFKRFPF LTISLPIAIE ADDVAGGLGY TKLRFEPDIR NSGMGLYAGT GIIGWLNRGW       240
     SIAEYRHNYA TNFGLGGLDR DYSLIVYDIT FGTSSWSSFW RLMLPLLVVM VMVLLVFKIR       300
     PDEQDARAGI PVTVLLTLVF LQQVYRGELP DLPFLTFLDL VYVIAYVITL FAFVLLVWIG       360
     RRYADMERMP LGEARDNLSK RLELLDEVWP LSMVLFCSVA VVTAWVLIPP GS               412
//

If you have problems or comments...

PBIL Back to PBIL home page