(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE618

CP000435.PE618       Location/Qualifiers
FT   CDS             608045..608587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0639"
FT                   /product="possible Early Protein (E6)"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46347"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICG5"
FT                   /protein_id="ABI46347.1"
FT                   /translation="MTWQVISLPFLMPSKPRNRVGEVYGKLTVIRASERRTKSGNAYWW
FT                   CRCSCGQDREVPGDKLSHNAARKKPIVTACFDCSREFQVEGVCAKNDREERQRRIDAQE
FT                   RRSLLKGVVPDGWLTLPLTDAHARELGQVLFFRGTVCLRGHLAPYRINGGCLTCSGQKP
FT                   SALNHAPTASAEVAHDA"
     MTWQVISLPF LMPSKPRNRV GEVYGKLTVI RASERRTKSG NAYWWCRCSC GQDREVPGDK        60
     LSHNAARKKP IVTACFDCSR EFQVEGVCAK NDREERQRRI DAQERRSLLK GVVPDGWLTL       120
     PLTDAHAREL GQVLFFRGTV CLRGHLAPYR INGGCLTCSG QKPSALNHAP TASAEVAHDA       180
//

If you have problems or comments...

PBIL Back to PBIL home page