(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE619

CP000435.PE619       Location/Qualifiers
FT   CDS             608633..608725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0640"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47364"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICG4"
FT                   /protein_id="ABI47364.1"
FT                   /translation="MAANQALPLIGMIAVLPKKRCFLNRSLVQA"
     MAANQALPLI GMIAVLPKKR CFLNRSLVQA                                         30
//

If you have problems or comments...

PBIL Back to PBIL home page