(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE621

CP000435.PE621       Location/Qualifiers
FT   CDS             609730..610446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0642"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47124"
FT                   /db_xref="GOA:Q0ICG2"
FT                   /db_xref="InterPro:IPR025067"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICG2"
FT                   /protein_id="ABI47124.1"
FT                   /translation="MGMAAVDWLWILHPFLAVVLVYPLIGVVVRLAVQTRARRLQNQKL
FT                   PATVGRDHSDLGRWLAAAVVVVVLIALSVVIGTKAPLAQFEGGLTRAIQLLLVLCGTIV
FT                   SLLALWRCKRPGLRLAFSLITWAGVLGLGAQPEVWRLSDNPLTPGFWQSHYWAGVGVTG
FT                   LMLFSLGARIEILRDIRIRRLHVTANVLAALLFLTQGLTGARDLLEIPLSWQKSTIYAC
FT                   DFNAKTCPSLDPNAQS"
     MGMAAVDWLW ILHPFLAVVL VYPLIGVVVR LAVQTRARRL QNQKLPATVG RDHSDLGRWL        60
     AAAVVVVVLI ALSVVIGTKA PLAQFEGGLT RAIQLLLVLC GTIVSLLALW RCKRPGLRLA       120
     FSLITWAGVL GLGAQPEVWR LSDNPLTPGF WQSHYWAGVG VTGLMLFSLG ARIEILRDIR       180
     IRRLHVTANV LAALLFLTQG LTGARDLLEI PLSWQKSTIY ACDFNAKTCP SLDPNAQS         238
//

If you have problems or comments...

PBIL Back to PBIL home page