(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE622

CP000435.PE622       Location/Qualifiers
FT   CDS             610558..611430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0643"
FT                   /product="lipase/esterase family protein"
FT                   /EC_number="3.1.1.-"
FT                   /note="identified by match to protein family HMM PF07859"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45304"
FT                   /db_xref="GOA:Q0ICG1"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICG1"
FT                   /protein_id="ABI45304.1"
FT                   /translation="MSQAFSALYRSFQTDVVTRVRCSPVEDTLYTWIDPPSGRSNFVSL
FT                   FFHGGGYTMGSTDDHLQLIASLVEDSGVSVLGVDYRLCPNNCFPAPLDDAEEAYRWLLA
FT                   QGYRSEAIAVAGISAGATLVTQLLHRCQSKSLPMPSLALVMAGVMDFSYGRESVVFNAS
FT                   DDLVSLQRLQAISSHYLPDDGSFDARDVFCMQQDYNSFPRTLFQVGDREVLLSDAIACF
FT                   STLKTAGHDVALHVVPGMIHCGQLFSRDFLPGQRATAEAALFLREGFAAIHASSVSGMG
FT                   ESKKQKTGH"
     MSQAFSALYR SFQTDVVTRV RCSPVEDTLY TWIDPPSGRS NFVSLFFHGG GYTMGSTDDH        60
     LQLIASLVED SGVSVLGVDY RLCPNNCFPA PLDDAEEAYR WLLAQGYRSE AIAVAGISAG       120
     ATLVTQLLHR CQSKSLPMPS LALVMAGVMD FSYGRESVVF NASDDLVSLQ RLQAISSHYL       180
     PDDGSFDARD VFCMQQDYNS FPRTLFQVGD REVLLSDAIA CFSTLKTAGH DVALHVVPGM       240
     IHCGQLFSRD FLPGQRATAE AALFLREGFA AIHASSVSGM GESKKQKTGH                  290
//

If you have problems or comments...

PBIL Back to PBIL home page