(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE626

CP000435.PE626       Location/Qualifiers
FT   CDS             complement(613335..613580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0647"
FT                   /product="NifU domain protein"
FT                   /note="identified by match to protein family HMM PF01106"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46656"
FT                   /db_xref="GOA:Q0ICF7"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICF7"
FT                   /protein_id="ABI46656.1"
FT                   /translation="MSTETMALTNENVEKVLDELRPFLMADGGNVEVVEIDGPVVKVRL
FT                   QGACGSCPSSTMTLKMGIERKMRESIPEVSEVVQVL"
     MSTETMALTN ENVEKVLDEL RPFLMADGGN VEVVEIDGPV VKVRLQGACG SCPSSTMTLK        60
     MGIERKMRES IPEVSEVVQV L                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page