(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE628

CP000435.PE628       Location/Qualifiers
FT   CDS             complement(615135..616271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0649"
FT                   /product="Glycerol dehydrogenase (GLDH)"
FT                   /EC_number="1.1.1.6"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47569"
FT                   /db_xref="GOA:Q0ICF5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICF5"
FT                   /protein_id="ABI47569.1"
FT                   /translation="MAYPLEQGCIHQRPLAVLASPGRYVQGPGATHELGRELKRLGLAD
FT                   SVLFIAGGTAQRCLARIWQAELPPLGLTPVIETFGGESSEAEIDRLVELAKTHTFTAVV
FT                   GAGGGKASDTARAVANELELPVVITPTLASTDSPCSALSVLYTEQGEMLSYRFYTRHPA
FT                   LVLVDTTVIAQAPKRQLVAGLGDALATWFEARTVRQSHVNNQLGGKPTTSGTALAKLCH
FT                   EILLTDGPAACAAVDAGVATPALERIVEANNLLSGLGFENGGLAAAHAVANGFSMIAGS
FT                   HRMLHGEKVAMGLHTQLVLEGQPQSEICEIFEYCRSVGLPTTLAQLGVNADSDKDIQTI
FT                   AERAVMPGETIHNEPFEVSAAAVDCALKAADQQGRAYA"
     MAYPLEQGCI HQRPLAVLAS PGRYVQGPGA THELGRELKR LGLADSVLFI AGGTAQRCLA        60
     RIWQAELPPL GLTPVIETFG GESSEAEIDR LVELAKTHTF TAVVGAGGGK ASDTARAVAN       120
     ELELPVVITP TLASTDSPCS ALSVLYTEQG EMLSYRFYTR HPALVLVDTT VIAQAPKRQL       180
     VAGLGDALAT WFEARTVRQS HVNNQLGGKP TTSGTALAKL CHEILLTDGP AACAAVDAGV       240
     ATPALERIVE ANNLLSGLGF ENGGLAAAHA VANGFSMIAG SHRMLHGEKV AMGLHTQLVL       300
     EGQPQSEICE IFEYCRSVGL PTTLAQLGVN ADSDKDIQTI AERAVMPGET IHNEPFEVSA       360
     AAVDCALKAA DQQGRAYA                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page