(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE630

CP000435.PE630       Location/Qualifiers
FT   CDS             complement(616654..616983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0651"
FT                   /product="possible drug resistance protein"
FT                   /note="identified by match to protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46248"
FT                   /db_xref="GOA:Q0ICF3"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICF3"
FT                   /protein_id="ABI46248.1"
FT                   /translation="MPAPWILLMLAIGSEVIGTSCLKLSEGFSRPIPTLVVLAAYSTSM
FT                   LLLSRVVQTIPLGITYALWSGIGIIAIVLVGLLAYKQVPSPGQLVGIATITAGVIIVNL
FT                   TGKHP"
     MPAPWILLML AIGSEVIGTS CLKLSEGFSR PIPTLVVLAA YSTSMLLLSR VVQTIPLGIT        60
     YALWSGIGII AIVLVGLLAY KQVPSPGQLV GIATITAGVI IVNLTGKHP                   109
//

If you have problems or comments...

PBIL Back to PBIL home page