(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE632

CP000435.PE632       Location/Qualifiers
FT   CDS             complement(618893..620404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0653"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47889"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICF1"
FT                   /protein_id="ABI47889.1"
FT                   /translation="MAEAVISLGASAVLVSASAAALSTTGSIISHTGEKTSLRQNASGG
FT                   LRLMGSEVQRGLHLLIKTKDTPKAELAHTDLNHQQYSSSIQECEAIAIDRKRAFQPAFG
FT                   IRMAELDRPVIYGLSTSARGNGYALERCGAPLTMDGRYGEVAETYIAPILQDIGVMPCQ
FT                   GNPDTCNSQVNPDGTEKSLNDIVKQLDLDFAVIANHGERTPARVAKEPAFAIETDSARK
FT                   LIKIVSPKTEEEQNPSYLEIKNGLRSVSRHDLHFAMYSRASKIEDASSNEQGALLNGAF
FT                   FRNISSNRVRFLLDGSGSMSACILWGSGRGQRRTYWNGNRYISTRKICALTRMESLQNE
FT                   LVMIINGLPDNTKINIESFSSRGYLNHRRWKPSVDGLISLDDSETRQSAISFVHSLNDG
FT                   SVTRWGGTIPWDGLDTALNDEETDTLYFLSDGEPNTNHQGRQWTNDEFSSTVDHYISKN
FT                   DQRGKKITINTTALGLNSNWMKDLANRSTGDYLMIDKNYITVAQQ"
     MAEAVISLGA SAVLVSASAA ALSTTGSIIS HTGEKTSLRQ NASGGLRLMG SEVQRGLHLL        60
     IKTKDTPKAE LAHTDLNHQQ YSSSIQECEA IAIDRKRAFQ PAFGIRMAEL DRPVIYGLST       120
     SARGNGYALE RCGAPLTMDG RYGEVAETYI APILQDIGVM PCQGNPDTCN SQVNPDGTEK       180
     SLNDIVKQLD LDFAVIANHG ERTPARVAKE PAFAIETDSA RKLIKIVSPK TEEEQNPSYL       240
     EIKNGLRSVS RHDLHFAMYS RASKIEDASS NEQGALLNGA FFRNISSNRV RFLLDGSGSM       300
     SACILWGSGR GQRRTYWNGN RYISTRKICA LTRMESLQNE LVMIINGLPD NTKINIESFS       360
     SRGYLNHRRW KPSVDGLISL DDSETRQSAI SFVHSLNDGS VTRWGGTIPW DGLDTALNDE       420
     ETDTLYFLSD GEPNTNHQGR QWTNDEFSST VDHYISKNDQ RGKKITINTT ALGLNSNWMK       480
     DLANRSTGDY LMIDKNYITV AQQ                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page