(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE634

CP000435.PE634       Location/Qualifiers
FT   CDS             complement(621396..621785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0655"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47090"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICE9"
FT                   /protein_id="ABI47090.1"
FT                   /translation="MIGISRVSISALTRTSIEQQRSRIEAEINSNMQLIQQANSRLTLE
FT                   SIPPLDRERACSAPEAYLISRINQAGATQHVPRPAMAERTFTITSLGEGWDVIEVAYQF
FT                   QAPEQTISTEQRMVELHPTFAPRCR"
     MIGISRVSIS ALTRTSIEQQ RSRIEAEINS NMQLIQQANS RLTLESIPPL DRERACSAPE        60
     AYLISRINQA GATQHVPRPA MAERTFTITS LGEGWDVIEV AYQFQAPEQT ISTEQRMVEL       120
     HPTFAPRCR                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page