(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE637

CP000435.PE637       Location/Qualifiers
FT   CDS             624462..624554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0658"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46865"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICE6"
FT                   /protein_id="ABI46865.1"
FT                   /translation="MLNKFDGISCLPIGSDTAWLLSAVYEEVFD"
     MLNKFDGISC LPIGSDTAWL LSAVYEEVFD                                         30
//

If you have problems or comments...

PBIL Back to PBIL home page