(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE643

CP000435.PE643       Location/Qualifiers
FT   CDS             complement(628270..628809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0664"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46545"
FT                   /db_xref="GOA:Q0ICE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICE0"
FT                   /protein_id="ABI46545.1"
FT                   /translation="MNIKGRYRHQSQHKVTANGFTIVEVLIAGILMASALTAVGRLSVA
FT                   ALSVSAHSSARASMEAAINDNIQTMQKEDSYFTQEWIKNNDKYNFETACSSPAETLGEH
FT                   LKTIDQDPRLIVHVDSEPSSTVVSKNKPITRTFDFSTIPGILKISYSFEGPEKQIEDEI
FT                   RVIEMNPNFASQCYQT"
     MNIKGRYRHQ SQHKVTANGF TIVEVLIAGI LMASALTAVG RLSVAALSVS AHSSARASME        60
     AAINDNIQTM QKEDSYFTQE WIKNNDKYNF ETACSSPAET LGEHLKTIDQ DPRLIVHVDS       120
     EPSSTVVSKN KPITRTFDFS TIPGILKISY SFEGPEKQIE DEIRVIEMNP NFASQCYQT        179
//

If you have problems or comments...

PBIL Back to PBIL home page