(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE644

CP000435.PE644       Location/Qualifiers
FT   CDS             complement(628903..630528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0665"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46106"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICD9"
FT                   /protein_id="ABI46106.1"
FT                   /translation="MGRKLGAAESYQQMAETAALNGFNRILSELNENNHREVDSDLNKD
FT                   KQGGGDEEVKSKYKGYLFTLNHNGGNPENPGSEQWGWNPANQTNFLLRELCTDRSQLPA
FT                   AVPADAGNANPPHTDLTAGTTSQRKDGQNNIKLQYRLRGYATTATAENNGLGEGRFQIE
FT                   GIVLRDGDDPKTNYLARTLLLRSLYVNSIVVGEGDWAVLSGPTLSLGDTKILKSNLDIG
FT                   NGKVLLNVSSAEPYQKETGCDPDDLLEDVRASDNNDNLKDRIVPILGGLPTSNIWDLGL
FT                   TQDKHPGSEHVRIWTFDDTQGLQECQSIACSRDTNTATAQSRPDIEEDNAAVIRLSTNE
FT                   LCNGKGSDCHVFVEHINLTNTRLLIETSASRPVVLHLEYPGTSTVAPSETGITGSISLG
FT                   NGSELCGVNNEETTCNAEPEQLVILSAAPKPSGVRSCDSVSPQTDQYVLAFDGDSLPNA
FT                   TVHLIPGFVKTGSSGTKLNGLIWADGICTNSGPFSLMTDTNGSSSVVRDLNDLWGWENK
FT                   NFPGYGQMVTRGIRGSGLDTFRRW"
     MGRKLGAAES YQQMAETAAL NGFNRILSEL NENNHREVDS DLNKDKQGGG DEEVKSKYKG        60
     YLFTLNHNGG NPENPGSEQW GWNPANQTNF LLRELCTDRS QLPAAVPADA GNANPPHTDL       120
     TAGTTSQRKD GQNNIKLQYR LRGYATTATA ENNGLGEGRF QIEGIVLRDG DDPKTNYLAR       180
     TLLLRSLYVN SIVVGEGDWA VLSGPTLSLG DTKILKSNLD IGNGKVLLNV SSAEPYQKET       240
     GCDPDDLLED VRASDNNDNL KDRIVPILGG LPTSNIWDLG LTQDKHPGSE HVRIWTFDDT       300
     QGLQECQSIA CSRDTNTATA QSRPDIEEDN AAVIRLSTNE LCNGKGSDCH VFVEHINLTN       360
     TRLLIETSAS RPVVLHLEYP GTSTVAPSET GITGSISLGN GSELCGVNNE ETTCNAEPEQ       420
     LVILSAAPKP SGVRSCDSVS PQTDQYVLAF DGDSLPNATV HLIPGFVKTG SSGTKLNGLI       480
     WADGICTNSG PFSLMTDTNG SSSVVRDLND LWGWENKNFP GYGQMVTRGI RGSGLDTFRR       540
     W                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page