(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE70

CP000435.PE70        Location/Qualifiers
FT   CDS             complement(74423..75418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0071"
FT                   /product="possible MesJ homolog"
FT                   /note="identified by match to protein family HMM PF01171;
FT                   match to protein family HMM TIGR02432"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46081"
FT                   /db_xref="GOA:Q0IE13"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE13"
FT                   /protein_id="ABI46081.1"
FT                   /translation="MAASKSWLPWHDTLHRQLLRQPNLLPDGETLLIALSGGQDSMALL
FT                   GLLLGLQHLHHWHFQLWHGDHGWHDQSAATASELKEWCQGQELDLQISRNTRDHTGTEA
FT                   SARSWRYQELAALSQQFCCRTVLTAHTASDRAETLLLQLARGTDLAGLGSLRPIRPLQN
FT                   NDPNGTRLVRPLLTFSRDDTTQICQDLQLPVWLDPSNANPAFSRNRIRNDVLPVLEELH
FT                   PGCSQRIAQLSERVSQVEDSQRTLATLALEQLRYERGLHRKALKVLPDATRRLLLHHWL
FT                   QQQGVRTLSASQLDTLSVAIGPGRPPGSRSLAEHKTLQWTRDSVQLVSQP"
     MAASKSWLPW HDTLHRQLLR QPNLLPDGET LLIALSGGQD SMALLGLLLG LQHLHHWHFQ        60
     LWHGDHGWHD QSAATASELK EWCQGQELDL QISRNTRDHT GTEASARSWR YQELAALSQQ       120
     FCCRTVLTAH TASDRAETLL LQLARGTDLA GLGSLRPIRP LQNNDPNGTR LVRPLLTFSR       180
     DDTTQICQDL QLPVWLDPSN ANPAFSRNRI RNDVLPVLEE LHPGCSQRIA QLSERVSQVE       240
     DSQRTLATLA LEQLRYERGL HRKALKVLPD ATRRLLLHHW LQQQGVRTLS ASQLDTLSVA       300
     IGPGRPPGSR SLAEHKTLQW TRDSVQLVSQ P                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page