(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE74

CP000435.PE74        Location/Qualifiers
FT   CDS             complement(78990..80807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0075"
FT                   /product="asparate kinase, monofunctional class"
FT                   /EC_number="2.7.2.4"
FT                   /note="identified by similarity to SP:P08495; match to
FT                   protein family HMM PF00696; match to protein family HMM
FT                   PF01842; match to protein family HMM TIGR00656; match to
FT                   protein family HMM TIGR00657"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46287"
FT                   /db_xref="GOA:Q0IE09"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE09"
FT                   /protein_id="ABI46287.1"
FT                   /translation="MALLVQKFGGTSVGSVERLQTVARRIADCKEDGNDLVIVVSAMGH
FT                   TTDELTAKAKAISSDPPQREMDMLLSTGEQVSIALLSMALHELGVPAVSMTGAQVGIVT
FT                   ESAHGRARILDVRTDRLRARLAEGQVVVVAGFQGTSLSSGGTAEITTLGRGGSDTSAVA
FT                   LAAALGADACEIFTDVPGVLTTDPRKVANAQLMPQVSCDEMLELASLGAAVLHPRAVEI
FT                   ARNYGVKMVVRSSWSDAPGTTLTSRNAKPIGREGLELGRPVDGVELLEDQAVLALSHVP
FT                   DQPGVAARLFESLSAGGVNVDLIIQATHEGSSNDITFTVAETDLEQARSICTTLVDSLG
FT                   GILSSDGGMSKLSIRGAGIMGRPGIAAGLFDTLSREGINLRLIATSEVKVSCVVEASMG
FT                   SKALQAAQQAFELSTQQQHINPPASGEGEPEVRGVALDRDQAQLSVRHVPDRPGMAGSL
FT                   CSALADAGISLDAIVQSERQHGDGSRDISFIVKREDRAASDQALAPLLAQWPGAVLEDG
FT                   PAIARVSAIGAGMPATAGTAGRMFRFLAEADVNIELIATSEIRTSCVVAESDGIKALEA
FT                   VHAGFQLGGSESHQAQGTESPLELEAFKP"
     MALLVQKFGG TSVGSVERLQ TVARRIADCK EDGNDLVIVV SAMGHTTDEL TAKAKAISSD        60
     PPQREMDMLL STGEQVSIAL LSMALHELGV PAVSMTGAQV GIVTESAHGR ARILDVRTDR       120
     LRARLAEGQV VVVAGFQGTS LSSGGTAEIT TLGRGGSDTS AVALAAALGA DACEIFTDVP       180
     GVLTTDPRKV ANAQLMPQVS CDEMLELASL GAAVLHPRAV EIARNYGVKM VVRSSWSDAP       240
     GTTLTSRNAK PIGREGLELG RPVDGVELLE DQAVLALSHV PDQPGVAARL FESLSAGGVN       300
     VDLIIQATHE GSSNDITFTV AETDLEQARS ICTTLVDSLG GILSSDGGMS KLSIRGAGIM       360
     GRPGIAAGLF DTLSREGINL RLIATSEVKV SCVVEASMGS KALQAAQQAF ELSTQQQHIN       420
     PPASGEGEPE VRGVALDRDQ AQLSVRHVPD RPGMAGSLCS ALADAGISLD AIVQSERQHG       480
     DGSRDISFIV KREDRAASDQ ALAPLLAQWP GAVLEDGPAI ARVSAIGAGM PATAGTAGRM       540
     FRFLAEADVN IELIATSEIR TSCVVAESDG IKALEAVHAG FQLGGSESHQ AQGTESPLEL       600
     EAFKP                                                                   605
//

If you have problems or comments...

PBIL Back to PBIL home page