(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE8

CP000435.PE8         Location/Qualifiers
FT   CDS             10474..11136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0008"
FT                   /product="unnamed protein product"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45564"
FT                   /db_xref="GOA:Q0IE75"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE75"
FT                   /protein_id="ABI45564.1"
FT                   /translation="MSASPSGSQALRLSFVLRWLGITLVVLLALQMAVLLSAADWADGV
FT                   FKQLLIERLVNQAPMGLIGLLLMLLGSRLDQPETARPPIRWLVCVISALLAILMIVVVP
FT                   VSISGNQNLSGESDQTLEQQKGQLEMARQQSANPENVKMLGNQLTQAGQLPADASEEDQ
FT                   VKAAQAFIDKQLAQMEQQIKQGERQRNLAVNQRRFGGTLSAVILAVAFVLLALAAVI"
     MSASPSGSQA LRLSFVLRWL GITLVVLLAL QMAVLLSAAD WADGVFKQLL IERLVNQAPM        60
     GLIGLLLMLL GSRLDQPETA RPPIRWLVCV ISALLAILMI VVVPVSISGN QNLSGESDQT       120
     LEQQKGQLEM ARQQSANPEN VKMLGNQLTQ AGQLPADASE EDQVKAAQAF IDKQLAQMEQ       180
     QIKQGERQRN LAVNQRRFGG TLSAVILAVA FVLLALAAVI                             220
//

If you have problems or comments...

PBIL Back to PBIL home page