(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE87

CP000435.PE87        Location/Qualifiers
FT   CDS             94883..95656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0089"
FT                   /product="Dienelactone hydrolase"
FT                   /EC_number="3.1.1.45"
FT                   /note="identified by match to protein family HMM PF01738"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45242"
FT                   /db_xref="GOA:Q0IDZ6"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDZ6"
FT                   /protein_id="ABI45242.1"
FT                   /translation="MSSVLPPVLPEPSPGAWVTVNTGPVPLHCWWAPTSNAKPATHAAI
FT                   VLPEIFGLNRWVRGVADRLSAAGVPALAMPLFARTAPELELGYDPESTREGRRHKETTS
FT                   TEGILTDVQASIDWLRLALASTGQPLRITVVGFCFGGHAALLAATLADVQVSLDFYGAG
FT                   VSRGRPGGGAPSLELLPSVEGELHCLCGSVDSLISDSDQQAIQSALKAGDPTGLRLRYS
FT                   VFEGADHGFMCEARDQYHQSSAQEGWRLLLDAAQS"
     MSSVLPPVLP EPSPGAWVTV NTGPVPLHCW WAPTSNAKPA THAAIVLPEI FGLNRWVRGV        60
     ADRLSAAGVP ALAMPLFART APELELGYDP ESTREGRRHK ETTSTEGILT DVQASIDWLR       120
     LALASTGQPL RITVVGFCFG GHAALLAATL ADVQVSLDFY GAGVSRGRPG GGAPSLELLP       180
     SVEGELHCLC GSVDSLISDS DQQAIQSALK AGDPTGLRLR YSVFEGADHG FMCEARDQYH       240
     QSSAQEGWRL LLDAAQS                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page