(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE9

CP000435.PE9         Location/Qualifiers
FT   CDS             11192..11941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04367"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46461"
FT                   /db_xref="GOA:Q0IE74"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE74"
FT                   /protein_id="ABI46461.1"
FT                   /translation="MVQSNTRPDLPLSARLQQDLKNDLIAGLLVVIPLATTIWLATTVS
FT                   RFVLAFLTSIPKQFNPFITLNPLLQDLINLALGLTVPLFAILLIGLMARNIVGRWLLEF
FT                   GEETLQRIPLAGSVYKTLKQLLATFLRDNSQRFRRVVLVEYPREGLYSVGFVTGEVGPS
FT                   LQAELTEPLLSVFIPTAPNPTTGWYTLVPEKSVKDLDISVEDAFRTIISAGIVNPDERE
FT                   APVNRSFSSLISQLRGSVSPSSSTTGA"
     MVQSNTRPDL PLSARLQQDL KNDLIAGLLV VIPLATTIWL ATTVSRFVLA FLTSIPKQFN        60
     PFITLNPLLQ DLINLALGLT VPLFAILLIG LMARNIVGRW LLEFGEETLQ RIPLAGSVYK       120
     TLKQLLATFL RDNSQRFRRV VLVEYPREGL YSVGFVTGEV GPSLQAELTE PLLSVFIPTA       180
     PNPTTGWYTL VPEKSVKDLD ISVEDAFRTI ISAGIVNPDE REAPVNRSFS SLISQLRGSV       240
     SPSSSTTGA                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page