(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE97

CP000435.PE97        Location/Qualifiers
FT   CDS             complement(103539..104435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0099"
FT                   /product="Predicted hydrolase"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45460"
FT                   /db_xref="GOA:Q0IDY6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDY6"
FT                   /protein_id="ABI45460.1"
FT                   /translation="MLWTWKSHQIGWSLVGDRTAPTAVLLIHGFGANTNHWRFNQPVLG
FT                   KQVPTYAIDLLGFGRSDQPQARLNDEPATAKTVQYCFDLWAQQVADFCHNVIDRPVVLV
FT                   GNSIGGVVALRAAQLLGEEHCKEVVLIDCAQRLMDDKQLATQPVWMAWIRPLLKTLVSQ
FT                   RWLSTTLFRNAARPALIRSVLKQAYPSGSNVDDELVSLLLRPSQRHGASEAFRGFINLF
FT                   NDHLAPDLLKNLSIPVHMIWGEADPWEPVKEAKEWKEKYECIQSLLVIPHAGHCPHDES
FT                   PKPVNKQLLLIVNQQAT"
     MLWTWKSHQI GWSLVGDRTA PTAVLLIHGF GANTNHWRFN QPVLGKQVPT YAIDLLGFGR        60
     SDQPQARLND EPATAKTVQY CFDLWAQQVA DFCHNVIDRP VVLVGNSIGG VVALRAAQLL       120
     GEEHCKEVVL IDCAQRLMDD KQLATQPVWM AWIRPLLKTL VSQRWLSTTL FRNAARPALI       180
     RSVLKQAYPS GSNVDDELVS LLLRPSQRHG ASEAFRGFIN LFNDHLAPDL LKNLSIPVHM       240
     IWGEADPWEP VKEAKEWKEK YECIQSLLVI PHAGHCPHDE SPKPVNKQLL LIVNQQAT         298
//

If you have problems or comments...

PBIL Back to PBIL home page