(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE99

CP000435.PE99        Location/Qualifiers
FT   CDS             complement(107718..108872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0101"
FT                   /product="efflux transporter, RND family, MFP subunit
FT                   subfamily"
FT                   /note="identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46401"
FT                   /db_xref="GOA:Q0IDY4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDY4"
FT                   /protein_id="ABI46401.1"
FT                   /translation="MVRGTIGCIVRGSFVVVLTLSVALAACGQSKKSGPTFLSINTATI
FT                   SQGNFKPSIKAVSPLESTTNVTLSPETDGRVIKKLVREGDQVQAGQVILVLDNTQLSAQ
FT                   LDASQSQARYDRVNAERYQFLYEQGAASAKRRDAYVTKAITSRDQAIADKATLNYKFVR
FT                   SPINGVIGDLDTVKIGDYVKTGDIITGIVDNSTLWTLMEIPASQASQVKVGQPVRLASQ
FT                   STPQVTGKGTITFVSPYYAIPKAGNPPNTLMVKAEFPNLTGQLKTGQYVTSEIITGSSE
FT                   RLAVPVQAVMMQAQQPFVYEVVPISKALPNIKRSPNTTAKALKTLEKLPGNTPIVLQTK
FT                   VQLGDLQNNLYPVISGLKSGDKVAISNTSRLRSGMPVKVSVGSN"
     MVRGTIGCIV RGSFVVVLTL SVALAACGQS KKSGPTFLSI NTATISQGNF KPSIKAVSPL        60
     ESTTNVTLSP ETDGRVIKKL VREGDQVQAG QVILVLDNTQ LSAQLDASQS QARYDRVNAE       120
     RYQFLYEQGA ASAKRRDAYV TKAITSRDQA IADKATLNYK FVRSPINGVI GDLDTVKIGD       180
     YVKTGDIITG IVDNSTLWTL MEIPASQASQ VKVGQPVRLA SQSTPQVTGK GTITFVSPYY       240
     AIPKAGNPPN TLMVKAEFPN LTGQLKTGQY VTSEIITGSS ERLAVPVQAV MMQAQQPFVY       300
     EVVPISKALP NIKRSPNTTA KALKTLEKLP GNTPIVLQTK VQLGDLQNNL YPVISGLKSG       360
     DKVAISNTSR LRSGMPVKVS VGSN                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page