(data stored in SCRATCH3701 zone)

EMBL: CP000435.PILB

CP000435.PILB        Location/Qualifiers
FT   CDS             complement(26600..28471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilB"
FT                   /locus_tag="sync_0021"
FT                   /product="type IV pilus assembly protein PilB"
FT                   /note="identified by match to protein family HMM PF00437"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46434"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE62"
FT                   /protein_id="ABI46434.1"
FT                   /translation="MEASPLILTRCKITSRHVEGSHGPTTSAESRISMSADSTRMPLPP
FT                   ALPAKLISEAELAAGEALLHSGQVLDLETWKQLQALPIHLTDDGLMVAIASSSDRNSRE
FT                   QLKQVLKSHGYITKLVLANGADLKRILDPQEFNSDSNISQTSISETAKSLLDGFDTEGI
FT                   LSADPDEAEIQSNSASSLDINSSITGASPVVTLVDRILIKALDMNASDIHVEPQQSGLQ
FT                   IRLRKDGVLTNLAQPLPIKLIPAITSRFKIMADLDIAERRQAQDGRIRRQYKGRTVDFR
FT                   VNSLPSRYGEKICLRLLDSQSTQLGLDKLISNPNTLELVRTLGSKPFGMILVTGPTGSG
FT                   KSTTLYSLLAERNEPGINISTVEDPIEYTLPGITQCQVNREKGFDFSTALRAFMRQDPD
FT                   VLLVGETRDQETAKTAIEAALTGHLVLTTLHCNDAPSAIARLDEMGVEPFMVSASLLGI
FT                   VSQRLLRRVCSECRIPYHPDSRELGRFGLMTSDEGNITFFKAKHHEGPETPCPTCQGTG
FT                   YKGRIGVYEVLRMNEALAASVAKGATTDLVRQLALEAGMKTLLGYSLDLVREGHTTLEE
FT                   VDRMVLTDAGLESEQRARALSTVTCRGCGGGLQEGWLECPYCLTPRQ"
     MEASPLILTR CKITSRHVEG SHGPTTSAES RISMSADSTR MPLPPALPAK LISEAELAAG        60
     EALLHSGQVL DLETWKQLQA LPIHLTDDGL MVAIASSSDR NSREQLKQVL KSHGYITKLV       120
     LANGADLKRI LDPQEFNSDS NISQTSISET AKSLLDGFDT EGILSADPDE AEIQSNSASS       180
     LDINSSITGA SPVVTLVDRI LIKALDMNAS DIHVEPQQSG LQIRLRKDGV LTNLAQPLPI       240
     KLIPAITSRF KIMADLDIAE RRQAQDGRIR RQYKGRTVDF RVNSLPSRYG EKICLRLLDS       300
     QSTQLGLDKL ISNPNTLELV RTLGSKPFGM ILVTGPTGSG KSTTLYSLLA ERNEPGINIS       360
     TVEDPIEYTL PGITQCQVNR EKGFDFSTAL RAFMRQDPDV LLVGETRDQE TAKTAIEAAL       420
     TGHLVLTTLH CNDAPSAIAR LDEMGVEPFM VSASLLGIVS QRLLRRVCSE CRIPYHPDSR       480
     ELGRFGLMTS DEGNITFFKA KHHEGPETPC PTCQGTGYKG RIGVYEVLRM NEALAASVAK       540
     GATTDLVRQL ALEAGMKTLL GYSLDLVREG HTTLEEVDRM VLTDAGLESE QRARALSTVT       600
     CRGCGGGLQE GWLECPYCLT PRQ                                               623
//

If you have problems or comments...

PBIL Back to PBIL home page