(data stored in SCRATCH3701 zone)

EMBL: CP000435.PILC

CP000435.PILC        Location/Qualifiers
FT   CDS             complement(24218..25498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC"
FT                   /locus_tag="sync_0019"
FT                   /product="type IV pilus assembly protein PilC"
FT                   /note="identified by match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47546"
FT                   /db_xref="GOA:Q0IE64"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE64"
FT                   /protein_id="ABI47546.1"
FT                   /translation="MVSFTATYTSATGQPRTVTVKANDAVSARRLLRRRGIKADELRQD
FT                   TSKRKGKEKFQAESKGAGGSSSAGWLSMDLGEAFQKPPGVKEKAIWASKLAALVDAGVP
FT                   IVRSLDLMATQQKLPMFKKALTSVGLEVNQGTAMAAAMRQWPKVFDQLTIAMVEAGEAG
FT                   GVLDESLKRLAKLLEDNARLQNQIKGALGYPVAVLVIAILVFLGMTIFLIPTFAGIFED
FT                   LGAELPLFTQLMVDLSALLRSSASVVFAGILMIGAWLIGRYYNTHKGRRVLDKLILKLP
FT                   LFGDLIMKTATAQFCRIFSSLTRAGVPILMSMEISSETAGNSIISDAILDSRTLVQEGV
FT                   LLSTALTRQKVLPDMALSMLSIGEETGEMDRMLSKVADFYEDEVSTSVKALTSMLEPAM
FT                   IVVVGGIVGSILLAMYLPMFTVFDQIQ"
     MVSFTATYTS ATGQPRTVTV KANDAVSARR LLRRRGIKAD ELRQDTSKRK GKEKFQAESK        60
     GAGGSSSAGW LSMDLGEAFQ KPPGVKEKAI WASKLAALVD AGVPIVRSLD LMATQQKLPM       120
     FKKALTSVGL EVNQGTAMAA AMRQWPKVFD QLTIAMVEAG EAGGVLDESL KRLAKLLEDN       180
     ARLQNQIKGA LGYPVAVLVI AILVFLGMTI FLIPTFAGIF EDLGAELPLF TQLMVDLSAL       240
     LRSSASVVFA GILMIGAWLI GRYYNTHKGR RVLDKLILKL PLFGDLIMKT ATAQFCRIFS       300
     SLTRAGVPIL MSMEISSETA GNSIISDAIL DSRTLVQEGV LLSTALTRQK VLPDMALSML       360
     SIGEETGEMD RMLSKVADFY EDEVSTSVKA LTSMLEPAMI VVVGGIVGSI LLAMYLPMFT       420
     VFDQIQ                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page