(data stored in SCRATCH3701 zone)

EMBL: CP000435.PILT

CP000435.PILT        Location/Qualifiers
FT   CDS             complement(25515..26579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="sync_0020"
FT                   /product="twitching motility protein"
FT                   /note="identified by similarity to SP:P24559; match to
FT                   protein family HMM PF00437; match to protein family HMM
FT                   TIGR01420"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46791"
FT                   /db_xref="GOA:Q0IE63"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE63"
FT                   /protein_id="ABI46791.1"
FT                   /translation="MIEDLMEQLVNGGGSDLHIASGQPPYGRFSGELRPMQEEPLSEEG
FT                   CNRLIFSMLNNSQRKTLEQTWELDCAYGLKGVARFRVNVYRQKGSYAACLRALGSKIPS
FT                   IQLLNLPPVVVETSKRPRGLVLVTGPTGSGKTTTLAALLDHINHTRAEHILTIEDPIEF
FT                   VYTSDLSLVHQRQLNEDTRSFANALRAALREDPDVILVGEMRDLETIQLAISAAETGHL
FT                   VFGTLHTSSAAQTVDRMVDVFPPSQQTQIRVQLSGSLTAVFSQTLCRRQNPAPGQFGRV
FT                   MAQEIMINTPAIANLIREGKTAQLYSQIQTGGELGMQTLERALANLIDQGEISLDEGQS
FT                   KASKPAELERLLNN"
     MIEDLMEQLV NGGGSDLHIA SGQPPYGRFS GELRPMQEEP LSEEGCNRLI FSMLNNSQRK        60
     TLEQTWELDC AYGLKGVARF RVNVYRQKGS YAACLRALGS KIPSIQLLNL PPVVVETSKR       120
     PRGLVLVTGP TGSGKTTTLA ALLDHINHTR AEHILTIEDP IEFVYTSDLS LVHQRQLNED       180
     TRSFANALRA ALREDPDVIL VGEMRDLETI QLAISAAETG HLVFGTLHTS SAAQTVDRMV       240
     DVFPPSQQTQ IRVQLSGSLT AVFSQTLCRR QNPAPGQFGR VMAQEIMINT PAIANLIREG       300
     KTAQLYSQIQ TGGELGMQTL ERALANLIDQ GEISLDEGQS KASKPAELER LLNN             354
//

If you have problems or comments...

PBIL Back to PBIL home page