(data stored in SCRATCH3701 zone)

EMBL: CP000435.PPC

CP000435.PPC         Location/Qualifiers
FT   CDS             complement(455232..458237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="sync_0460"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="identified by match to protein family HMM PF00311"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46533"
FT                   /db_xref="GOA:Q0ICY4"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICY4"
FT                   /protein_id="ABI46533.1"
FT                   /translation="MIPSDSGFPSMHSSSALIPESTQPRADGNEAGGGQLLQQRLALVE
FT                   DLWRTVLRSECPPEQAEQLLRMKQLSDPVLPGEHPAGTDALIDLIKGMDLAEAIAAARA
FT                   FSLYFQLVNILEQRIEEDTYLESINRSQDQAEQFDPFAPPLATQTEPATFRELFERLRR
FT                   LNVPPAQLEALLQELDIRLVFTAHPTEIVRHTVRHKQRRVASLLQQLETQPPTPSGATD
FT                   SVRLQLEEEIRLWWRTDELHQFKPSVLDEVDYALHYFQQVLFNAMPQLRRRIVASLAAS
FT                   YPDVRVPSSSFCTFGSWVGSDRDGNPSVTTEITWRTACYQRQLMLDRYISAVQHLRNQL
FT                   SISMQWSQVSPPLLESLEMDRLRFPDVYEERATRYRLEPYRLKLSFVLERLRLTQLRNQ
FT                   QLADAGWRTPPEGLPSFTPGNAPGDALHYGSIAEFRSELELIRTSLVNTDLSCEPLDTL
FT                   LTQVHIFGFSLAGLDIRQESTRHSDALDELSRYINPDRAYGAMDEAERVAWLMEELQTR
FT                   RPLIPPAVSWSAATAETVDVFRMLHRLQDEFGSRICGTYVISMSHSVSDLLEVLLLAKE
FT                   AGLVDPSARHADLLVVPLFETVEDLQRAPEVMEHLFQTPLYRDLLPKVGTQGLLLQELM
FT                   LGYSDSNKDSGFLSSNWEIHQAQIALQDLASRQGIALRLFHGRGGSVGRGGGPAYQAIL
FT                   AQPSGTLQGRIKITEQGEVLASKYSLPELALYNLETVTTAVIQNSLVTNQLDATPSWNK
FT                   LMSRVAKSSRRNYRALVHDNPDLVAFFQQVTPIEEISKLQISSRPARRKTGTRDLSSLR
FT                   AIPWVFGWTQSRFLLPSWFGVGSALSEELEADPDQLTLLRTLHQRWPFFRMLISKVEMT
FT                   LSKVDLDLARHYVTSLGSAEHHEAFEKIYATVAEEYARTKELVLAITGQERLLDADPAL
FT                   QLSVDLRNRTIVPLGFLQVALLRRLRDQNRQPPMSESPSSDGDGRTYSRSELLRGALLT
FT                   INGIAAGMRNTG"
     MIPSDSGFPS MHSSSALIPE STQPRADGNE AGGGQLLQQR LALVEDLWRT VLRSECPPEQ        60
     AEQLLRMKQL SDPVLPGEHP AGTDALIDLI KGMDLAEAIA AARAFSLYFQ LVNILEQRIE       120
     EDTYLESINR SQDQAEQFDP FAPPLATQTE PATFRELFER LRRLNVPPAQ LEALLQELDI       180
     RLVFTAHPTE IVRHTVRHKQ RRVASLLQQL ETQPPTPSGA TDSVRLQLEE EIRLWWRTDE       240
     LHQFKPSVLD EVDYALHYFQ QVLFNAMPQL RRRIVASLAA SYPDVRVPSS SFCTFGSWVG       300
     SDRDGNPSVT TEITWRTACY QRQLMLDRYI SAVQHLRNQL SISMQWSQVS PPLLESLEMD       360
     RLRFPDVYEE RATRYRLEPY RLKLSFVLER LRLTQLRNQQ LADAGWRTPP EGLPSFTPGN       420
     APGDALHYGS IAEFRSELEL IRTSLVNTDL SCEPLDTLLT QVHIFGFSLA GLDIRQESTR       480
     HSDALDELSR YINPDRAYGA MDEAERVAWL MEELQTRRPL IPPAVSWSAA TAETVDVFRM       540
     LHRLQDEFGS RICGTYVISM SHSVSDLLEV LLLAKEAGLV DPSARHADLL VVPLFETVED       600
     LQRAPEVMEH LFQTPLYRDL LPKVGTQGLL LQELMLGYSD SNKDSGFLSS NWEIHQAQIA       660
     LQDLASRQGI ALRLFHGRGG SVGRGGGPAY QAILAQPSGT LQGRIKITEQ GEVLASKYSL       720
     PELALYNLET VTTAVIQNSL VTNQLDATPS WNKLMSRVAK SSRRNYRALV HDNPDLVAFF       780
     QQVTPIEEIS KLQISSRPAR RKTGTRDLSS LRAIPWVFGW TQSRFLLPSW FGVGSALSEE       840
     LEADPDQLTL LRTLHQRWPF FRMLISKVEM TLSKVDLDLA RHYVTSLGSA EHHEAFEKIY       900
     ATVAEEYART KELVLAITGQ ERLLDADPAL QLSVDLRNRT IVPLGFLQVA LLRRLRDQNR       960
     QPPMSESPSS DGDGRTYSRS ELLRGALLTI NGIAAGMRNT G                          1001
//

If you have problems or comments...

PBIL Back to PBIL home page