(data stored in SCRATCH3701 zone)

EMBL: CP000435.PSAE

CP000435.PSAE        Location/Qualifiers
FT   CDS             complement(537955..538164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaE"
FT                   /locus_tag="sync_0562"
FT                   /product="photosystem I reaction center subunit IV"
FT                   /note="identified by match to protein family HMM PF02427"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47445"
FT                   /db_xref="GOA:Q0ICP0"
FT                   /db_xref="InterPro:IPR003375"
FT                   /db_xref="InterPro:IPR008990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICP0"
FT                   /protein_id="ABI47445.1"
FT                   /translation="MAISRGDKVRIKRPESYWYNDVGTVASIDTSGIRYPVVVRFEKVN
FT                   YNGISGSEGGINTNNFAQAELEPA"
     MAISRGDKVR IKRPESYWYN DVGTVASIDT SGIRYPVVVR FEKVNYNGIS GSEGGINTNN        60
     FAQAELEPA                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page