(data stored in SCRATCH3701 zone)

EMBL: CP000435.PSAL

CP000435.PSAL        Location/Qualifiers
FT   CDS             complement(412763..413254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaL"
FT                   /locus_tag="sync_0398"
FT                   /product="photosystem I reaction center subunit XI"
FT                   /note="identified by match to protein family HMM PF02605"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45715"
FT                   /db_xref="GOA:Q0ID43"
FT                   /db_xref="InterPro:IPR003757"
FT                   /db_xref="InterPro:IPR022980"
FT                   /db_xref="InterPro:IPR036592"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID43"
FT                   /protein_id="ABI45715.1"
FT                   /translation="MTVTPAADPCVGNLATPVNSGYFMKWLINNLPFYRQGISPNFRGI
FT                   ETGAAFGYLLYGPYTICGPLRNTDYSATAGLLAAIGAVHLLTLLFLLYNQPGKQPHIPP
FT                   ADVTVDNPPADLFTRNGWSEFTSGFWLGGCGGAVFAWLLCDTLHVQELVKIAAGVWSVS
FT                   "
     MTVTPAADPC VGNLATPVNS GYFMKWLINN LPFYRQGISP NFRGIETGAA FGYLLYGPYT        60
     ICGPLRNTDY SATAGLLAAI GAVHLLTLLF LLYNQPGKQP HIPPADVTVD NPPADLFTRN       120
     GWSEFTSGFW LGGCGGAVFA WLLCDTLHVQ ELVKIAAGVW SVS                         163
//

If you have problems or comments...

PBIL Back to PBIL home page