(data stored in SCRATCH3701 zone)

EMBL: CP000435.PSBA-1

CP000435.PSBA-1      Location/Qualifiers
FT   CDS             complement(371860..372939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbA-1"
FT                   /locus_tag="sync_0368"
FT                   /product="photosystem II protein D1"
FT                   /note="identified by match to protein family HMM PF00124;
FT                   match to protein family HMM TIGR01151"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46731"
FT                   /db_xref="GOA:Q0I7J2"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005867"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I7J2"
FT                   /protein_id="ABI46731.1"
FT                   /translation="MTTTIQQRSGANGWQQFCDWVTSTNNRLYVGWFGVLMIPTLLAAT
FT                   TCFIVAFIAAPPVDIDGIREPVAGSLMYGNNIISGAVVPSSNAIGLHFYPIWEAASLDE
FT                   WLYNGGPFQLVVFHFLIGIYAYMGREWELSYRLGMRPWICVAYSAPVAAASAVFLVYPF
FT                   GQGSFSDAMPLGISGTFNYMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSS
FT                   LVRETTETESQNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVV
FT                   GIWFTALGVSTMAFNLNGFNFNQSILDGQGRVLNTWADVLNRAGLGMEVMHERNAHNFP
FT                   LDLAAAESTPVALQAPAIG"
     MTTTIQQRSG ANGWQQFCDW VTSTNNRLYV GWFGVLMIPT LLAATTCFIV AFIAAPPVDI        60
     DGIREPVAGS LMYGNNIISG AVVPSSNAIG LHFYPIWEAA SLDEWLYNGG PFQLVVFHFL       120
     IGIYAYMGRE WELSYRLGMR PWICVAYSAP VAAASAVFLV YPFGQGSFSD AMPLGISGTF       180
     NYMLVFQAEH NILMHPFHML GVAGVFGGSL FSAMHGSLVT SSLVRETTET ESQNYGYKFG       240
     QEEETYNIVA AHGYFGRLIF QYASFNNSRS LHFFLAAWPV VGIWFTALGV STMAFNLNGF       300
     NFNQSILDGQ GRVLNTWADV LNRAGLGMEV MHERNAHNFP LDLAAAESTP VALQAPAIG        359
//

If you have problems or comments...

PBIL Back to PBIL home page