(data stored in SCRATCH3701 zone)

EMBL: CP000435.PSBF

CP000435.PSBF        Location/Qualifiers
FT   CDS             complement(249262..249399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbF"
FT                   /locus_tag="sync_0238"
FT                   /product="cytochrome b559, beta subunit"
FT                   /note="identified by match to protein family HMM PF00283;
FT                   match to protein family HMM TIGR01333"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46888"
FT                   /db_xref="GOA:Q0IDJ8"
FT                   /db_xref="InterPro:IPR006216"
FT                   /db_xref="InterPro:IPR006241"
FT                   /db_xref="InterPro:IPR013081"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDJ8"
FT                   /protein_id="ABI46888.1"
FT                   /translation="MTQTPATSTPRNYPIFTVRWLALHTLGVPTVFFLGALAAMQFIRR
FT                   "
     MTQTPATSTP RNYPIFTVRW LALHTLGVPT VFFLGALAAM QFIRR                        45
//

If you have problems or comments...

PBIL Back to PBIL home page