(data stored in SCRATCH3701 zone)

EMBL: CP000435.PSBJ

CP000435.PSBJ        Location/Qualifiers
FT   CDS             complement(248912..249112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbJ"
FT                   /locus_tag="sync_0236"
FT                   /product="photosystem II reaction center protein PsbJ"
FT                   /note="identified by match to protein family HMM PF01788"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45649"
FT                   /db_xref="GOA:Q0IDK0"
FT                   /db_xref="InterPro:IPR002682"
FT                   /db_xref="InterPro:IPR037267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDK0"
FT                   /protein_id="ABI45649.1"
FT                   /translation="MSGKKSNLPDGRIPDRLPDGRPAVAWKSRWTEGTLPLWLVATAGG
FT                   MAVIFVVGLFFYGSYVGVGSA"
     MSGKKSNLPD GRIPDRLPDG RPAVAWKSRW TEGTLPLWLV ATAGGMAVIF VVGLFFYGSY        60
     VGVGSA                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page