(data stored in SCRATCH3701 zone)

EMBL: CP000435.PSBL

CP000435.PSBL        Location/Qualifiers
FT   CDS             complement(249124..249243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbL"
FT                   /locus_tag="sync_0237"
FT                   /product="photosystem II reaction center protein PsbL"
FT                   /note="identified by match to protein family HMM PF02419"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47307"
FT                   /db_xref="GOA:Q0IDJ9"
FT                   /db_xref="InterPro:IPR003372"
FT                   /db_xref="InterPro:IPR037266"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDJ9"
FT                   /protein_id="ABI47307.1"
FT                   /translation="MERNPNPNNLPVELNRTSLYLGLLIVFTTGILFSSYFFN"
     MERNPNPNNL PVELNRTSLY LGLLIVFTTG ILFSSYFFN                               39
//

If you have problems or comments...

PBIL Back to PBIL home page