(data stored in SCRATCH3701 zone)

EMBL: CP000435.PSBO

CP000435.PSBO        Location/Qualifiers
FT   CDS             356701..357522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbO"
FT                   /locus_tag="sync_0353"
FT                   /product="photosystem II manganese-stabilizing protein"
FT                   /note="identified by match to protein family HMM PF01716"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45616"
FT                   /db_xref="GOA:Q0ID87"
FT                   /db_xref="InterPro:IPR002628"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID87"
FT                   /protein_id="ABI45616.1"
FT                   /translation="MRIRPLLAMVLALCLFVVTACSGGAEAIDRSNVTYDDIRNTGKAN
FT                   DCPTLPDSARGSISLTAGSAYELRGICMHPSQVFVKGEPANKRQEAQFVEGKILTRYTS
FT                   SLDEVFGDLSVGANGLSFSEKGGIDFQPITVLVPGGEEFPFTFSSKNLQATADGSSLTT
FT                   STDFNGTYRTPSYRTSNFIDPKGRALTTGVDYPQGLVGLGGDYEELESENVKRYIDGTG
FT                   EMSFSITKVDPETGEFAGVFTAIQPSDSDMGGREIVDVKISGEVFGRLEEA"
     MRIRPLLAMV LALCLFVVTA CSGGAEAIDR SNVTYDDIRN TGKANDCPTL PDSARGSISL        60
     TAGSAYELRG ICMHPSQVFV KGEPANKRQE AQFVEGKILT RYTSSLDEVF GDLSVGANGL       120
     SFSEKGGIDF QPITVLVPGG EEFPFTFSSK NLQATADGSS LTTSTDFNGT YRTPSYRTSN       180
     FIDPKGRALT TGVDYPQGLV GLGGDYEELE SENVKRYIDG TGEMSFSITK VDPETGEFAG       240
     VFTAIQPSDS DMGGREIVDV KISGEVFGRL EEA                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page