(data stored in SCRATCH3701 zone)

EMBL: CP000435.PURH

CP000435.PURH        Location/Qualifiers
FT   CDS             299545..301134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="sync_0289"
FT                   /product="bifunctional purine biosynthesis protein PurH"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="identified by match to protein family HMM PF01808;
FT                   match to protein family HMM PF02142; match to protein
FT                   family HMM TIGR00355"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46591"
FT                   /db_xref="GOA:Q0IDE8"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDE8"
FT                   /protein_id="ABI46591.1"
FT                   /translation="MAPTALLSVSDKRGVVPLAEALHRLHGYQLLSSGGTAKVLQEAGL
FT                   PVTRVADHTGAPEILGGRVKTLHPRIHGGILARRGDPAHEADLLEQQIDPIDVVVVNLY
FT                   PFRETVATPDVSWDAAIENIDIGGPTMVRSAAKNHAHVAVLTSPEQYDRFLKALSGSAG
FT                   GVNANVRRQLALEAFAHTAAYDVAISRWMQSRPELQPDVEAAAPAEALPWLEALPLRQT
FT                   LRYGENPHQKAAWFSSPMGWGGAKQLQGKALSTNNLLDLEAALATVREFGYGSSGLHPA
FT                   QQAAAVVVKHTNPCGVAVGDGVGIALTRALDGDRISAFGGIVALNAVVDGPAAKELTSL
FT                   FLECVVAPGYSSEALEILAAKGNLRLLELPPEAIDAAPKDHVRSILGGVLVQDLDDQPI
FT                   DPSAWTVASQRQPTTAETADLRFAWQLVRHVRSNAILVARDGQSLGVGAGQMNRVGSAR
FT                   IALEAAGEQAVGAVLASDGFFPFDDTVRLAASHGIKAVIHPGGSLRDADSIKACDELGL
FT                   AMVLTGRRHFLH"
     MAPTALLSVS DKRGVVPLAE ALHRLHGYQL LSSGGTAKVL QEAGLPVTRV ADHTGAPEIL        60
     GGRVKTLHPR IHGGILARRG DPAHEADLLE QQIDPIDVVV VNLYPFRETV ATPDVSWDAA       120
     IENIDIGGPT MVRSAAKNHA HVAVLTSPEQ YDRFLKALSG SAGGVNANVR RQLALEAFAH       180
     TAAYDVAISR WMQSRPELQP DVEAAAPAEA LPWLEALPLR QTLRYGENPH QKAAWFSSPM       240
     GWGGAKQLQG KALSTNNLLD LEAALATVRE FGYGSSGLHP AQQAAAVVVK HTNPCGVAVG       300
     DGVGIALTRA LDGDRISAFG GIVALNAVVD GPAAKELTSL FLECVVAPGY SSEALEILAA       360
     KGNLRLLELP PEAIDAAPKD HVRSILGGVL VQDLDDQPID PSAWTVASQR QPTTAETADL       420
     RFAWQLVRHV RSNAILVARD GQSLGVGAGQ MNRVGSARIA LEAAGEQAVG AVLASDGFFP       480
     FDDTVRLAAS HGIKAVIHPG GSLRDADSIK ACDELGLAMV LTGRRHFLH                   529
//

If you have problems or comments...

PBIL Back to PBIL home page