(data stored in SCRATCH3701 zone)

EMBL: CP000435.PYRE

CP000435.PYRE        Location/Qualifiers
FT   CDS             complement(287284..287853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="sync_0276"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR00336"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45906"
FT                   /db_xref="GOA:Q0IDG0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDG0"
FT                   /protein_id="ABI45906.1"
FT                   /translation="MSQRFEHDPLLERLAKEAYRHGNFTLASGRSSHHYVNCKPVSLSG
FT                   SGLALLCPAMLALVETDAAAVGGLTLGADPLVSGVALAAAQRGRSLNALIVRKQAKGHG
FT                   TGAWLEGPLPEQGALVTVLEDVVTTGGSSIKAVEQLRAAGYIVNRVVTIVDREEGGAAA
FT                   MQAAGLELHSLYRLEEVAAQSRELQA"
     MSQRFEHDPL LERLAKEAYR HGNFTLASGR SSHHYVNCKP VSLSGSGLAL LCPAMLALVE        60
     TDAAAVGGLT LGADPLVSGV ALAAAQRGRS LNALIVRKQA KGHGTGAWLE GPLPEQGALV       120
     TVLEDVVTTG GSSIKAVEQL RAAGYIVNRV VTIVDREEGG AAAMQAAGLE LHSLYRLEEV       180
     AAQSRELQA                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page