(data stored in SCRATCH3701 zone)

EMBL: CP000435.QUEA

CP000435.QUEA        Location/Qualifiers
FT   CDS             591097..592206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="sync_0619"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase(Queuosine biosynthesis protein
FT                   queA)"
FT                   /EC_number="5.-.-.-"
FT                   /note="identified by match to protein family HMM PF02547"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46506"
FT                   /db_xref="GOA:Q0ICI5"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICI5"
FT                   /protein_id="ABI46506.1"
FT                   /translation="MPDSRDLQLSSYDYVLPEDRIAQAPVEPRHDARLLVVPPAERSLS
FT                   ELRHQRVWDWQQELQPGDLLVVNDTRVLKARLRVRRSGGGLGELLVLEPRGEGRWLCLA
FT                   RPAKRMRPGDQLWLEALEQEPLSLAVLANDAASGGRIVQFPPDCVDALSLEGLLERYGE
FT                   VPLPPYITRHDSSDQERYQTRYATRPGAVAAPTAGLHLSDALLAAIAERGVALAHVTLH
FT                   VGLGTFRPVETEDLSDLTLHSEWVEVRAEVVEAVLACRARGGRVIAVGTTSVRALEAAA
FT                   AGGGGLQPLKGPVDLVIQPGYRFQVVQGLLTNFHLPKSSLLLLVSALIGRDQLLQIYNA
FT                   AIEEMYRFYSYGDAMWIAPEAVLFDARPE"
     MPDSRDLQLS SYDYVLPEDR IAQAPVEPRH DARLLVVPPA ERSLSELRHQ RVWDWQQELQ        60
     PGDLLVVNDT RVLKARLRVR RSGGGLGELL VLEPRGEGRW LCLARPAKRM RPGDQLWLEA       120
     LEQEPLSLAV LANDAASGGR IVQFPPDCVD ALSLEGLLER YGEVPLPPYI TRHDSSDQER       180
     YQTRYATRPG AVAAPTAGLH LSDALLAAIA ERGVALAHVT LHVGLGTFRP VETEDLSDLT       240
     LHSEWVEVRA EVVEAVLACR ARGGRVIAVG TTSVRALEAA AAGGGGLQPL KGPVDLVIQP       300
     GYRFQVVQGL LTNFHLPKSS LLLLVSALIG RDQLLQIYNA AIEEMYRFYS YGDAMWIAPE       360
     AVLFDARPE                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page