(data stored in SCRATCH3701 zone)

EMBL: CP000435.RECF

CP000435.RECF        Location/Qualifiers
FT   CDS             complement(453473..454510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="sync_0457"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by match to protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45500"
FT                   /db_xref="GOA:Q0ICY6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICY6"
FT                   /protein_id="ABI45500.1"
FT                   /translation="MIGSNGVGKSNLLESVELLGSLRSHRSSQDGDLIHWDASRALLKA
FT                   TCADQQILELELRRRGGRQAKRNGKSLQRQLDLIGPLRCVGFSALDLHLVRGEPALRRQ
FT                   WLDRVVLQLEPVYADLISRYGRLLRQRAQFWRRGGLSSGMEPQALLESFDTQMALVSTR
FT                   IHRRRLRALARLEPLAAVWQDRLSEGREHLQLGYSPGSALIGEEQEESWRLSIEQQLRE
FT                   QRSEEERLGSCRVGPHRDEIEMRINGTAARRFGSAGQQRTLVLALKMAELQLVGELCGE
FT                   PPLLLLDDVLAELDPTRQLALLEAVGENHQCLVSATHLDAFEGGWREQSQILDADSLRS
FT                   QSGAR"
     MIGSNGVGKS NLLESVELLG SLRSHRSSQD GDLIHWDASR ALLKATCADQ QILELELRRR        60
     GGRQAKRNGK SLQRQLDLIG PLRCVGFSAL DLHLVRGEPA LRRQWLDRVV LQLEPVYADL       120
     ISRYGRLLRQ RAQFWRRGGL SSGMEPQALL ESFDTQMALV STRIHRRRLR ALARLEPLAA       180
     VWQDRLSEGR EHLQLGYSPG SALIGEEQEE SWRLSIEQQL REQRSEEERL GSCRVGPHRD       240
     EIEMRINGTA ARRFGSAGQQ RTLVLALKMA ELQLVGELCG EPPLLLLDDV LAELDPTRQL       300
     ALLEAVGENH QCLVSATHLD AFEGGWREQS QILDADSLRS QSGAR                       345
//

If you have problems or comments...

PBIL Back to PBIL home page