(data stored in SCRATCH3701 zone)

EMBL: CP000435.RECQ

CP000435.RECQ        Location/Qualifiers
FT   CDS             539398..540888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="sync_0564"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by similarity to SP:P15043; match to
FT                   protein family HMM PF00270; match to protein family HMM
FT                   PF00271; match to protein family HMM TIGR00614; match to
FT                   protein family HMM TIGR01389"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46197"
FT                   /db_xref="GOA:Q0ICN8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICN8"
FT                   /protein_id="ABI46197.1"
FT                   /translation="MDSLLEALHRHYGWDSFRSGQRPVIEALLSGRDCLAVLPTGGGKS
FT                   LCFQLPALVRQGLVVVISPLVALMDDQVLQLQRRGIAAACLHRGIQPEQRRLIQTQLSA
FT                   GSLRLLYLAPERLQGEAARDMLSAYARDGRLVALAVDEAHCISAWGHDFRPDYRRLGQL
FT                   RALCPGVPLVALSATAAPRVRADILRLLGLCKPLIQVSSAQRTNLKYTMRRRPSDPLPD
FT                   VLEALQDSRGATLIYARTRRSVELWAERLQAQGIPAITYHAGLEPERREEALMHFLEAD
FT                   APVLVATVAFGMGVDRPDVGLVLHLDLPATPEGYLQESGRAGRDGRPAHCLVLFSPGDR
FT                   TSLGWAMQSTLRRASESKVSDDDVWRVEFSQQQLRRMEAVAEGEICREQALLLSVGELT
FT                   SPCGRCDRCLAQVRPKDWSDRAQELLEVIDAGQGADIRSLTERLRELDGSEERWGWLAR
FT                   RLVQEELIRESNDGAQRLSLRDSGRQFLHAPWPLHYAA"
     MDSLLEALHR HYGWDSFRSG QRPVIEALLS GRDCLAVLPT GGGKSLCFQL PALVRQGLVV        60
     VISPLVALMD DQVLQLQRRG IAAACLHRGI QPEQRRLIQT QLSAGSLRLL YLAPERLQGE       120
     AARDMLSAYA RDGRLVALAV DEAHCISAWG HDFRPDYRRL GQLRALCPGV PLVALSATAA       180
     PRVRADILRL LGLCKPLIQV SSAQRTNLKY TMRRRPSDPL PDVLEALQDS RGATLIYART       240
     RRSVELWAER LQAQGIPAIT YHAGLEPERR EEALMHFLEA DAPVLVATVA FGMGVDRPDV       300
     GLVLHLDLPA TPEGYLQESG RAGRDGRPAH CLVLFSPGDR TSLGWAMQST LRRASESKVS       360
     DDDVWRVEFS QQQLRRMEAV AEGEICREQA LLLSVGELTS PCGRCDRCLA QVRPKDWSDR       420
     AQELLEVIDA GQGADIRSLT ERLRELDGSE ERWGWLARRL VQEELIRESN DGAQRLSLRD       480
     SGRQFLHAPW PLHYAA                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page