(data stored in SCRATCH3701 zone)

EMBL: CP000435.RFFM

CP000435.RFFM        Location/Qualifiers
FT   CDS             293986..294897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rffM"
FT                   /locus_tag="sync_0282"
FT                   /product="Glycosyl transferase WecB/TagA/CpsF family
FT                   protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF03808;
FT                   match to protein family HMM TIGR00696"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46935"
FT                   /db_xref="GOA:Q0IDF5"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDF5"
FT                   /protein_id="ABI46935.1"
FT                   /translation="MAISRLFSFSRRSSCCSLGFGCDKTVAFQATGFRFSLADELGMDI
FT                   TSTGPRDQRRFQVLGVPVDACRDVTAAAIGVHADGGGQIVTLNAEMTMAARANLRLGAV
FT                   IADADLVVPDGAGVVWALRLQGVRVRRSPGIELAWELLSYAEAHGWSVALVGSAPQVME
FT                   RLCDRLVVERPELRLVLAQHGYLTEEDWPQLEANLCELNPDLVLVALGVPRQELWVQRL
FT                   KASQTGVWMGVGGSFDVWAGLKERAPQWASRLQVEWLYRLLQEPSRWRRYLALPQFVWA
FT                   VLLSGSRRKPAKQKQATGKTTE"
     MAISRLFSFS RRSSCCSLGF GCDKTVAFQA TGFRFSLADE LGMDITSTGP RDQRRFQVLG        60
     VPVDACRDVT AAAIGVHADG GGQIVTLNAE MTMAARANLR LGAVIADADL VVPDGAGVVW       120
     ALRLQGVRVR RSPGIELAWE LLSYAEAHGW SVALVGSAPQ VMERLCDRLV VERPELRLVL       180
     AQHGYLTEED WPQLEANLCE LNPDLVLVAL GVPRQELWVQ RLKASQTGVW MGVGGSFDVW       240
     AGLKERAPQW ASRLQVEWLY RLLQEPSRWR RYLALPQFVW AVLLSGSRRK PAKQKQATGK       300
     TTE                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page