(data stored in SCRATCH3701 zone)

EMBL: CP000435.RNHB

CP000435.RNHB        Location/Qualifiers
FT   CDS             382146..382739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="sync_0375"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by similarity to SP:O31744; match to
FT                   protein family HMM PF01351"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46246"
FT                   /db_xref="GOA:Q0ID65"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID65"
FT                   /protein_id="ABI46246.1"
FT                   /translation="MIASDGLGIAGVDEVGRGCLFGPVFAAAVVLSDHAAEHLQAAGLT
FT                   DSKALTPSRRAALVPLIEAHAHAWGLGQSSARAVDRDGIRSATEQAMLCALQRLPCRPQ
FT                   LVLVDGVLPLRLWEGSQRTIVRGDSSHAAIAAASVLAKEARDALIRRLSNRFPGYGLER
FT                   HAGYGTAQHRAALLACGPTPLHRHSFLRKLFATV"
     MIASDGLGIA GVDEVGRGCL FGPVFAAAVV LSDHAAEHLQ AAGLTDSKAL TPSRRAALVP        60
     LIEAHAHAWG LGQSSARAVD RDGIRSATEQ AMLCALQRLP CRPQLVLVDG VLPLRLWEGS       120
     QRTIVRGDSS HAAIAAASVL AKEARDALIR RLSNRFPGYG LERHAGYGTA QHRAALLACG       180
     PTPLHRHSFL RKLFATV                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page