(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPLC

CP000435.RPLC        Location/Qualifiers
FT   CDS             complement(435133..435789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="sync_0437"
FT                   /product="ribosomal protein L3"
FT                   /note="identified by match to protein family HMM PF00297"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45670"
FT                   /db_xref="GOA:Q0ID05"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID05"
FT                   /protein_id="ABI45670.1"
FT                   /translation="MSIGILGKKLGMSQFFDEQGKAVPVTLIEAGPCRITQLKSSETDG
FT                   YQAVQIGFGEIREKLINKPAKGHLAKSGEDLVRHLCEYRVDDLDGIQLGGAVTVGDFAA
FT                   GQKVDVSGDTMGRGFAGLQKRHGFSRGPMTHGSKNHRQPGSIGAGTTPGRIYPGKRMSG
FT                   RYGGKKITTRGLTILKIDSERNLLVVKGSVPGKPGSLLNIRPANRVGAKPAKGGK"
     MSIGILGKKL GMSQFFDEQG KAVPVTLIEA GPCRITQLKS SETDGYQAVQ IGFGEIREKL        60
     INKPAKGHLA KSGEDLVRHL CEYRVDDLDG IQLGGAVTVG DFAAGQKVDV SGDTMGRGFA       120
     GLQKRHGFSR GPMTHGSKNH RQPGSIGAGT TPGRIYPGKR MSGRYGGKKI TTRGLTILKI       180
     DSERNLLVVK GSVPGKPGSL LNIRPANRVG AKPAKGGK                               218
//

If you have problems or comments...

PBIL Back to PBIL home page