(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPLD

CP000435.RPLD        Location/Qualifiers
FT   CDS             complement(434498..435133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="sync_0436"
FT                   /product="ribosomal protein L4"
FT                   /note="identified by match to protein family HMM PF00573"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45086"
FT                   /db_xref="GOA:Q0ID06"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID06"
FT                   /protein_id="ABI45086.1"
FT                   /translation="MANCIVRDWQGKEAGKASLDLKVAKEASALDLMHRAVLRQQAHSR
FT                   QGTASTLTRSEVRGGGRKPYKQKGTGRARQGSVRTPLRPGGGIIFGPKPRSYNLAMNRK
FT                   ERRSALRTALMARIEDLVVVKDFATTLTTPKTKEIIDALGRLDVSATSKVLIILTNPSE
FT                   AVRRSIRNLETVKLIAADQLNVFDLLHANKLVVGEDALAKIQEVYGDD"
     MANCIVRDWQ GKEAGKASLD LKVAKEASAL DLMHRAVLRQ QAHSRQGTAS TLTRSEVRGG        60
     GRKPYKQKGT GRARQGSVRT PLRPGGGIIF GPKPRSYNLA MNRKERRSAL RTALMARIED       120
     LVVVKDFATT LTTPKTKEII DALGRLDVSA TSKVLIILTN PSEAVRRSIR NLETVKLIAA       180
     DQLNVFDLLH ANKLVVGEDA LAKIQEVYGD D                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page