(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPLN

CP000435.RPLN        Location/Qualifiers
FT   CDS             complement(430546..430911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="sync_0427"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by match to protein family HMM PF00238;
FT                   match to protein family HMM TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47567"
FT                   /db_xref="GOA:Q0ID15"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID15"
FT                   /protein_id="ABI47567.1"
FT                   /translation="MIQQETFLTVADNSGAKRIQCIRVLGTNRRYAHVGDVIVATVKDA
FT                   MPNMGVKKSDIVKAVVVRTKATMRRDTGNSIRFDDNAAVIINDDKNPKGTRVFGPVARE
FT                   LRERSFTKIVSLAPEVI"
     MIQQETFLTV ADNSGAKRIQ CIRVLGTNRR YAHVGDVIVA TVKDAMPNMG VKKSDIVKAV        60
     VVRTKATMRR DTGNSIRFDD NAAVIINDDK NPKGTRVFGP VARELRERSF TKIVSLAPEV       120
     I                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page