(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPLP

CP000435.RPLP        Location/Qualifiers
FT   CDS             complement(431406..431873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="sync_0430"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by match to protein family HMM PF00252;
FT                   match to protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45536"
FT                   /db_xref="GOA:Q0ID12"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID12"
FT                   /protein_id="ABI45536.1"
FT                   /translation="MLSPKRVKFRKQQRGRMRGVATRGNTIAFGQFALQAQECGWITSR
FT                   QIEASRRAMTRYVKRGGKIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVIKPGRILF
FT                   EMGGEEITPEIAKEAMRLAQYKLPLKTKFICLDEQEQPAGTKAAASSTVES"
     MLSPKRVKFR KQQRGRMRGV ATRGNTIAFG QFALQAQECG WITSRQIEAS RRAMTRYVKR        60
     GGKIWIRIFP DKPVTMRPAE TRMGSGKGNP EFWVAVIKPG RILFEMGGEE ITPEIAKEAM       120
     RLAQYKLPLK TKFICLDEQE QPAGTKAAAS STVES                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page