(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPLR

CP000435.RPLR        Location/Qualifiers
FT   CDS             complement(428221..428589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="sync_0422"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by match to protein family HMM PF00861;
FT                   match to protein family HMM TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47544"
FT                   /db_xref="GOA:Q0ID20"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID20"
FT                   /protein_id="ABI47544.1"
FT                   /translation="MSTLSRKQQTQKRHRRLRRHLSGTANRPRLAVFRSNSHIYAQLID
FT                   DEAQSTLCSASTLDKDLRSSLKTNCSSCDASVAVGDLVAKRAIAKGIQQVVFDRGGNLY
FT                   HGRVKALADAAREAGLQF"
     MSTLSRKQQT QKRHRRLRRH LSGTANRPRL AVFRSNSHIY AQLIDDEAQS TLCSASTLDK        60
     DLRSSLKTNC SSCDASVAVG DLVAKRAIAK GIQQVVFDRG GNLYHGRVKA LADAAREAGL       120
     QF                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page