(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPLW

CP000435.RPLW        Location/Qualifiers
FT   CDS             complement(434203..434505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="sync_0435"
FT                   /product="ribosomal protein L23"
FT                   /note="identified by match to protein family HMM PF00276"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46523"
FT                   /db_xref="GOA:Q0ID07"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID07"
FT                   /protein_id="ABI46523.1"
FT                   /translation="MTERFTGRLADVIRRPLITEKATRALEQNQYTFEVDHRAAKPDIK
FT                   AAVEQLFDVKVTGISTMNPPRRSRRIGRFAGKRAQVKKAVVRLAEGNSIQLFPES"
     MTERFTGRLA DVIRRPLITE KATRALEQNQ YTFEVDHRAA KPDIKAAVEQ LFDVKVTGIS        60
     TMNPPRRSRR IGRFAGKRAQ VKKAVVRLAE GNSIQLFPES                             100
//

If you have problems or comments...

PBIL Back to PBIL home page