(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPMI

CP000435.RPMI        Location/Qualifiers
FT   CDS             complement(59911..60108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="sync_0059"
FT                   /product="ribosomal protein L35"
FT                   /note="identified by match to protein family HMM PF01632;
FT                   match to protein family HMM TIGR00001"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47147"
FT                   /db_xref="GOA:Q0IE25"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE25"
FT                   /protein_id="ABI47147.1"
FT                   /translation="MPKLKTRKAAAKRFKATGTGKFMRRRAFHNHLLDHKTPKQKRHLK
FT                   TKAVVDRTDEERVTLMMPYA"
     MPKLKTRKAA AKRFKATGTG KFMRRRAFHN HLLDHKTPKQ KRHLKTKAVV DRTDEERVTL        60
     MMPYA                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page