(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPOA

CP000435.RPOA        Location/Qualifiers
FT   CDS             complement(423039..423977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="sync_0414"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01000;
FT                   match to protein family HMM PF01193; match to protein
FT                   family HMM PF03118; match to protein family HMM TIGR02027"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47852"
FT                   /db_xref="GOA:Q0ID28"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID28"
FT                   /protein_id="ABI47852.1"
FT                   /translation="MLQYQIDRIEHQITDDRSQTGVFLIGPLERGQATTLGNSLRRMLM
FT                   GNLAGTAVTAVRIAGVNHEYATIPGVREDVLDILLNCKQLTVTSRTDELEIGRLIVSGP
FT                   AVVKAKDLQFSSQVQVVDGERPIATVSEGHSLELEVHVERGVGYRPVDRHNEDTSAIDL
FT                   LQIDAVFMPVHRVNFTTDETAVAEGGSARERLRMEVVTDGSMTPDDAIAQAANQLIELF
FT                   QPLATVTMVEEPGIEPEPSAEAQIPLEELNLSVRAYNCLKRAQVNSVSDLMGFSYEDLL
FT                   EIKNFGSKSADEVIEALERIGISIPQSRTSV"
     MLQYQIDRIE HQITDDRSQT GVFLIGPLER GQATTLGNSL RRMLMGNLAG TAVTAVRIAG        60
     VNHEYATIPG VREDVLDILL NCKQLTVTSR TDELEIGRLI VSGPAVVKAK DLQFSSQVQV       120
     VDGERPIATV SEGHSLELEV HVERGVGYRP VDRHNEDTSA IDLLQIDAVF MPVHRVNFTT       180
     DETAVAEGGS ARERLRMEVV TDGSMTPDDA IAQAANQLIE LFQPLATVTM VEEPGIEPEP       240
     SAEAQIPLEE LNLSVRAYNC LKRAQVNSVS DLMGFSYEDL LEIKNFGSKS ADEVIEALER       300
     IGISIPQSRT SV                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page