(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPSA

CP000435.RPSA        Location/Qualifiers
FT   CDS             complement(513071..513988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="sync_0531"
FT                   /product="ribosomal protein S1"
FT                   /note="identified by similarity to SP:P46228; match to
FT                   protein family HMM PF00575"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47704"
FT                   /db_xref="GOA:Q0ICR5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICR5"
FT                   /protein_id="ABI47704.1"
FT                   /translation="MDGAGFTIDDFASLLSKYDYNFKPGDIVNGTVFALETKGAMIDIG
FT                   AKTAAFMPLQEVSINRVEGLSDVLQPGEIREFFIMSEENEDGQLSLSVRRIEYQRAWER
FT                   VRQLQKEDATIYSEVFATNRGGALVRVEGLRGFIPGSHISTRKPKEELVADFLPLKFLE
FT                   VDEERNRLVLSHRRALVERKMNRLEVGEVVIGTVRGIKPYGAFIDIGGVSGLLHISEIS
FT                   HEHIETPHSVLNVNDQMKVMIIDLDAERGRISLSTKALEPEPGDMLTDPQKVFDKAEEM
FT                   AARYKQMLLEQAEEGEEPLSSMMV"
     MDGAGFTIDD FASLLSKYDY NFKPGDIVNG TVFALETKGA MIDIGAKTAA FMPLQEVSIN        60
     RVEGLSDVLQ PGEIREFFIM SEENEDGQLS LSVRRIEYQR AWERVRQLQK EDATIYSEVF       120
     ATNRGGALVR VEGLRGFIPG SHISTRKPKE ELVADFLPLK FLEVDEERNR LVLSHRRALV       180
     ERKMNRLEVG EVVIGTVRGI KPYGAFIDIG GVSGLLHISE ISHEHIETPH SVLNVNDQMK       240
     VMIIDLDAER GRISLSTKAL EPEPGDMLTD PQKVFDKAEE MAARYKQMLL EQAEEGEEPL       300
     SSMMV                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page