(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPSJ

CP000435.RPSJ        Location/Qualifiers
FT   CDS             complement(385863..386183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="sync_0380"
FT                   /product="ribosomal protein S10"
FT                   /note="identified by match to protein family HMM PF00338;
FT                   match to protein family HMM TIGR01049"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46021"
FT                   /db_xref="GOA:Q0ID60"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID60"
FT                   /protein_id="ABI46021.1"
FT                   /translation="MSTAIAQQKIRIRLKAFDRRMLDLSCDKIIETADNTAATAIGPIP
FT                   LPTKRKIYCVLRSPHVDKDSREHFETRTHRRIIDIYSPSAKTIDALMKLDLPSGVDIEV
FT                   KL"
     MSTAIAQQKI RIRLKAFDRR MLDLSCDKII ETADNTAATA IGPIPLPTKR KIYCVLRSPH        60
     VDKDSREHFE TRTHRRIIDI YSPSAKTIDA LMKLDLPSGV DIEVKL                      106
//

If you have problems or comments...

PBIL Back to PBIL home page